(data stored in ACNUC30630 zone)

EMBL: CP001737.PE461

CP001737.PE461       Location/Qualifiers
FT   CDS             530538..531182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0480"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: scl:sce5431 two-component
FT                   system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76899"
FT                   /db_xref="GOA:C8X730"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C8X730"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV76899.1"
FT                   /translation="MSVRVVVVDDNELLRAGLVTVLTSDPDIEVVGQAADGPAGVRACR
FT                   EHRPDLVLMDVEMPGGDGIVATRRIVTDLPDVRVLILTMFDLDDYVVEALRAGAAGFLL
FT                   KTTPPRDLIRSVRQCAAGETTVGPTVMARLVDSYVGHQEPPPPGLAELTGRELDVLRCL
FT                   ADGRSNAEIAGELFLAETTVKTHVARILAKLGVRDRVQAVVIAHRCGLARG"
     MSVRVVVVDD NELLRAGLVT VLTSDPDIEV VGQAADGPAG VRACREHRPD LVLMDVEMPG        60
     GDGIVATRRI VTDLPDVRVL ILTMFDLDDY VVEALRAGAA GFLLKTTPPR DLIRSVRQCA       120
     AGETTVGPTV MARLVDSYVG HQEPPPPGLA ELTGRELDVL RCLADGRSNA EIAGELFLAE       180
     TTVKTHVARI LAKLGVRDRV QAVVIAHRCG LARG                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page