(data stored in ACNUC30630 zone)

EMBL: CP001737.PE466

CP001737.PE466       Location/Qualifiers
FT   CDS             537363..537821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0485"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: cak:Caul_0809 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76904"
FT                   /db_xref="GOA:C8X735"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8X735"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACV76904.1"
FT                   /translation="MTPPVPAAGRSQLETQLLRQVQVTGSMAEQALARRLGVNGTDLAA
FT                   MGHVSAAEPPIGPRDLSQRLGLSPAAVTEVVDRLESAGHLVRERDTLDRRRVRLRPSAP
FT                   ATTRVLAELAPLMHDLDELAETFDDAERAAIRRYLRGVVDAFTRFQLP"
     MTPPVPAAGR SQLETQLLRQ VQVTGSMAEQ ALARRLGVNG TDLAAMGHVS AAEPPIGPRD        60
     LSQRLGLSPA AVTEVVDRLE SAGHLVRERD TLDRRRVRLR PSAPATTRVL AELAPLMHDL       120
     DELAETFDDA ERAAIRRYLR GVVDAFTRFQ LP                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page