(data stored in ACNUC30630 zone)

EMBL: CP001737.PE467

CP001737.PE467       Location/Qualifiers
FT   CDS             complement(537799..539025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0486"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   bpy:Bphyt_2660 integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76905"
FT                   /db_xref="GOA:C8X736"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8X736"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV76905.1"
FT                   /translation="MTQVQQIVRDAAQRGLNLQLTLRALLAAFVLGTLAFLPPADAAEL
FT                   SWWVAGGYLVAVAGLTLWLRRGDRIALTWGWLGLYVDLIALLTLTQIAGWSADQSWTSY
FT                   VLQFGFFLIPVLAATQLRWGVCAGVVIPTVLLYAAEGLLTRDANEVEPIPSIVLRVVAL
FT                   AGVGLAAVWLSRIQRSRVASIQALVDDRTRLLTELMTATDSAHRAMAENLHDGALQYVL
FT                   AARMDLEDARDGAPDEAARSFDRLDDALTQTAKLLRSTVSELHPAVLEQSGLALAVGQL
FT                   AGTAAERGGLTVSVESAGWPDEARTDQDQLLFGVARELISNVVRHAHASRMAIGLELAD
FT                   GVAELTVSDDGIGFTPGTAARKLSEGHIGVDSQRVKVEAAGGRFSVDSPAAGGATVRVQ
FT                   VPVRAAGTG"
     MTQVQQIVRD AAQRGLNLQL TLRALLAAFV LGTLAFLPPA DAAELSWWVA GGYLVAVAGL        60
     TLWLRRGDRI ALTWGWLGLY VDLIALLTLT QIAGWSADQS WTSYVLQFGF FLIPVLAATQ       120
     LRWGVCAGVV IPTVLLYAAE GLLTRDANEV EPIPSIVLRV VALAGVGLAA VWLSRIQRSR       180
     VASIQALVDD RTRLLTELMT ATDSAHRAMA ENLHDGALQY VLAARMDLED ARDGAPDEAA       240
     RSFDRLDDAL TQTAKLLRST VSELHPAVLE QSGLALAVGQ LAGTAAERGG LTVSVESAGW       300
     PDEARTDQDQ LLFGVARELI SNVVRHAHAS RMAIGLELAD GVAELTVSDD GIGFTPGTAA       360
     RKLSEGHIGV DSQRVKVEAA GGRFSVDSPA AGGATVRVQV PVRAAGTG                    408
//

If you have problems or comments...

PBIL Back to PBIL home page