(data stored in ACNUC30630 zone)

EMBL: CP001737.PE473

CP001737.PE473       Location/Qualifiers
FT   CDS             543798..544952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0492"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   mxa:MXAN_2881 alcohol dehydrogenase, iron- containing"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76911"
FT                   /db_xref="GOA:C8X742"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:C8X742"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ACV76911.1"
FT                   /translation="MSGPTFEFATATRIVFGPGRAQELPALVAGWGERVVVLTGSRPDR
FT                   HRALIDALPMDAAIVTVSGEPTVGVAREAVAAAREHGAQAVVSLGGGSVIDLGKTVAML
FT                   LGNGGDPLDYLEVIGRGQPIGRPSVPFAAVPTTAGTGAEVTMNAVLASPEHGRKASVRA
FT                   RSMLPALALVDPLLTVDCPPAVTAASGLDALTQCLEPLVSRNATPITDALAAQGLRHAA
FT                   AGLRAAYADGTDVAARTEMALCSLLGGLSLANAKLGAVHGFAGVIGGLVPVAHGAICAA
FT                   LLAPVTEANVRALRERAADHPALAAYRQAAELLTGRSDATVEDGVEWIAATVRQLGITG
FT                   LAAGGLDPALVDEVVDKTGSSSSTKGNPIELTPAELRQALVAAL"
     MSGPTFEFAT ATRIVFGPGR AQELPALVAG WGERVVVLTG SRPDRHRALI DALPMDAAIV        60
     TVSGEPTVGV AREAVAAARE HGAQAVVSLG GGSVIDLGKT VAMLLGNGGD PLDYLEVIGR       120
     GQPIGRPSVP FAAVPTTAGT GAEVTMNAVL ASPEHGRKAS VRARSMLPAL ALVDPLLTVD       180
     CPPAVTAASG LDALTQCLEP LVSRNATPIT DALAAQGLRH AAAGLRAAYA DGTDVAARTE       240
     MALCSLLGGL SLANAKLGAV HGFAGVIGGL VPVAHGAICA ALLAPVTEAN VRALRERAAD       300
     HPALAAYRQA AELLTGRSDA TVEDGVEWIA ATVRQLGITG LAAGGLDPAL VDEVVDKTGS       360
     SSSTKGNPIE LTPAELRQAL VAAL                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page