(data stored in ACNUC30630 zone)

EMBL: CP001737.PE478

CP001737.PE478       Location/Qualifiers
FT   CDS             complement(548294..550492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0497"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76916"
FT                   /db_xref="GOA:C8X747"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C8X747"
FT                   /inference="protein motif:PFAM:PF03176"
FT                   /protein_id="ACV76916.1"
FT                   /translation="MSRLLTRLGYTAAVHPWRIIAGWVVALALTLALSATVGGSPHDDY
FT                   TVAGSASQAGSDLLTERFGDTYATDARVVVRDPDGSLDPAVVDALSGRLAGLPHVVAVD
FT                   PPRMSADGDTALLTVRYDVPVTDFTGSAAVDALRSATAPTEQAGLTVALGGQVPENFAP
FT                   PSGVAELVGVLIALLILVFAFGSVVAAGLPMAVALVGLGVGSSLIALLAAVADVSTVAP
FT                   TVAAMVGLGVGIDYALLLVTRFVEGLRAGLPVPDAAARANGTAGVSVVFAGTTVLVSLI
FT                   GLRLADLSTYTTVGIATLLVVLSVMLTSITLVPALCGLVGRRVLGRRARRAPGADAAAG
FT                   RPRAAEPGATATARWAHRVGRRPWPWALGALTLLLVLAAPVLGMRTWPQDAGSQPESNT
FT                   TRIAYDLVADEFGPGANGPFLLAVDLTGTAGSAGQTVVSQLTERVAADPGVAAVAPPVL
FT                   NPAGDAALIIVQPTTGPQDEATVELLHRLRAELPQTVRVTGLTAVFADISDRLADRLWV
FT                   VIAFVVGVSLLLLTAAFRSVIVAVKAAAMNLLSVAAAYGVMVAIFQWGWGAELLGLPHA
FT                   VAISSWVPILMFTILFGLSMDYQVFLLSRIREDYLATDDPRGSVVRGLAGTGRVITCAA
FT                   AIMVAVFVGFGLDADPVVKMMGVGMAVAVLIDATVVRMVLVPATMSILGRANWWLPRWL
FT                   DRVLPHLDTEGSDPRPVGSADPTGGDAASTHPAPAGVA"
     MSRLLTRLGY TAAVHPWRII AGWVVALALT LALSATVGGS PHDDYTVAGS ASQAGSDLLT        60
     ERFGDTYATD ARVVVRDPDG SLDPAVVDAL SGRLAGLPHV VAVDPPRMSA DGDTALLTVR       120
     YDVPVTDFTG SAAVDALRSA TAPTEQAGLT VALGGQVPEN FAPPSGVAEL VGVLIALLIL       180
     VFAFGSVVAA GLPMAVALVG LGVGSSLIAL LAAVADVSTV APTVAAMVGL GVGIDYALLL       240
     VTRFVEGLRA GLPVPDAAAR ANGTAGVSVV FAGTTVLVSL IGLRLADLST YTTVGIATLL       300
     VVLSVMLTSI TLVPALCGLV GRRVLGRRAR RAPGADAAAG RPRAAEPGAT ATARWAHRVG       360
     RRPWPWALGA LTLLLVLAAP VLGMRTWPQD AGSQPESNTT RIAYDLVADE FGPGANGPFL       420
     LAVDLTGTAG SAGQTVVSQL TERVAADPGV AAVAPPVLNP AGDAALIIVQ PTTGPQDEAT       480
     VELLHRLRAE LPQTVRVTGL TAVFADISDR LADRLWVVIA FVVGVSLLLL TAAFRSVIVA       540
     VKAAAMNLLS VAAAYGVMVA IFQWGWGAEL LGLPHAVAIS SWVPILMFTI LFGLSMDYQV       600
     FLLSRIREDY LATDDPRGSV VRGLAGTGRV ITCAAAIMVA VFVGFGLDAD PVVKMMGVGM       660
     AVAVLIDATV VRMVLVPATM SILGRANWWL PRWLDRVLPH LDTEGSDPRP VGSADPTGGD       720
     AASTHPAPAG VA                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page