(data stored in ACNUC30630 zone)

EMBL: CP001737.PE483

CP001737.PE483       Location/Qualifiers
FT   CDS             556219..557166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0502"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   aha:AHA_1635 cytosolic long-chain acyl-CoA thioester
FT                   hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76921"
FT                   /db_xref="GOA:C8X752"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:C8X752"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACV76921.1"
FT                   /translation="MATGQSEITLRFLAAPTDVATLGGSIHGGRVLEWIDKAAYALAVG
FT                   WSGHYCVTAYVGDIRFTRPIESGNLVEVTARLMRTGRSSMDVHVTVSSADPQDAVYTEA
FT                   TTCVVVFVAVDAQGRSTAVPAWTPVTELDHRLLSDALERVTVRRNIENAMAEQTYTSQG
FT                   TAPSMTLRFLAAPTDVNWGGKAHGGTVMRWIDEAAYAVAAGWCKGAAIAAYSGGVRFYR
FT                   PIQIGHVVELEARLLRTGRSSMHIAVLVSSGSPITGEMQLTTHCLTIFVALDEAGKAKP
FT                   VPRWRPQSAEDKALDAHALHLVELRRQIQPTALD"
     MATGQSEITL RFLAAPTDVA TLGGSIHGGR VLEWIDKAAY ALAVGWSGHY CVTAYVGDIR        60
     FTRPIESGNL VEVTARLMRT GRSSMDVHVT VSSADPQDAV YTEATTCVVV FVAVDAQGRS       120
     TAVPAWTPVT ELDHRLLSDA LERVTVRRNI ENAMAEQTYT SQGTAPSMTL RFLAAPTDVN       180
     WGGKAHGGTV MRWIDEAAYA VAAGWCKGAA IAAYSGGVRF YRPIQIGHVV ELEARLLRTG       240
     RSSMHIAVLV SSGSPITGEM QLTTHCLTIF VALDEAGKAK PVPRWRPQSA EDKALDAHAL       300
     HLVELRRQIQ PTALD                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page