(data stored in ACNUC30630 zone)

EMBL: CP001737.PE489

CP001737.PE489       Location/Qualifiers
FT   CDS             566249..567295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0508"
FT                   /product="Dipeptidylaminopeptidase/acylaminoacyl-peptidase-like
FT                   protein"
FT                   /note="KEGG: ara:Arad_7409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76927"
FT                   /db_xref="GOA:C8X758"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8X758"
FT                   /inference="protein motif:COG:COG1506"
FT                   /protein_id="ACV76927.1"
FT                   /translation="MKPARTAIAVLAGALLLAACGSAATPRPAPASTTAPSASVPSAVG
FT                   PAAPVDPAGPAASDDPAGPPSEQAGDPSGDAPGDPSGALPAAFSDDETMVWIPAGDHRV
FT                   PGTLALPAAAPGRPVPAVLLLHGDLSSRDENAQMFARLAAALAARGIASLRIDFAGTGD
FT                   SEEPDLALDYPDMVADATASLDYLRADEVVDPARVAVLGLSRGGGVGATVTGTEPGVAA
FT                   FVSWSGAVYNGYDEDPDGHDLAREDGYVPLDVGDRTFKLGLNWFDTIEQSHPLDDISGY
FT                   TGPVLAVVGSDDQIVDPEVSTIFLDTVASPDTTLHVVDGADHGFSADQAVGDEAIGVTT
FT                   DWLVARLG"
     MKPARTAIAV LAGALLLAAC GSAATPRPAP ASTTAPSASV PSAVGPAAPV DPAGPAASDD        60
     PAGPPSEQAG DPSGDAPGDP SGALPAAFSD DETMVWIPAG DHRVPGTLAL PAAAPGRPVP       120
     AVLLLHGDLS SRDENAQMFA RLAAALAARG IASLRIDFAG TGDSEEPDLA LDYPDMVADA       180
     TASLDYLRAD EVVDPARVAV LGLSRGGGVG ATVTGTEPGV AAFVSWSGAV YNGYDEDPDG       240
     HDLAREDGYV PLDVGDRTFK LGLNWFDTIE QSHPLDDISG YTGPVLAVVG SDDQIVDPEV       300
     STIFLDTVAS PDTTLHVVDG ADHGFSADQA VGDEAIGVTT DWLVARLG                    348
//

If you have problems or comments...

PBIL Back to PBIL home page