(data stored in ACNUC30630 zone)

EMBL: CP001737.PE495

CP001737.PE495       Location/Qualifiers
FT   CDS             complement(572390..573670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0514"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: xca:xccb100_1974 periplasmic binding protein
FT                   precursor of a sugar import ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76933"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C8X764"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACV76933.1"
FT                   /translation="MFRKKAITAGLLAGLVVLSACGRSSDTAGAAGTSAPAASISAGPA
FT                   TGKLTMWAQGAEGQDLPALLDEFEAANPGVTVDVTAIPWDAAHNKYQTAIAGGQTPDIA
FT                   QMGTTWMGDFADAFDPTPAELTDAGFFPGSVNSTEVDGTAVGVPWYVDTRVVFYRKDLA
FT                   EKAGYTTFPTNYDDFKAMAKALQDKAGAQWGIQLLAGGTDSFQSTLPFGWSAGASLMDS
FT                   GNDAWTLDSPQWVDALTYYQSFFTEGIANPAPNMGAGAAESAFVDGSAPMMISGPYEIG
FT                   NLEKAGGADFTDKYAVATLPKDKSATSFVGGSNLVVFKDSPNRDAAWKLVQWLSQPEVQ
FT                   VKWYQATGDLPSVQSAWQEGVLADDPMLSVFGDQLKDTNSPPAVPTWTQVSAAADSQVE
FT                   QIVKAGKDPAQALQELQSQAASIGIGR"
     MFRKKAITAG LLAGLVVLSA CGRSSDTAGA AGTSAPAASI SAGPATGKLT MWAQGAEGQD        60
     LPALLDEFEA ANPGVTVDVT AIPWDAAHNK YQTAIAGGQT PDIAQMGTTW MGDFADAFDP       120
     TPAELTDAGF FPGSVNSTEV DGTAVGVPWY VDTRVVFYRK DLAEKAGYTT FPTNYDDFKA       180
     MAKALQDKAG AQWGIQLLAG GTDSFQSTLP FGWSAGASLM DSGNDAWTLD SPQWVDALTY       240
     YQSFFTEGIA NPAPNMGAGA AESAFVDGSA PMMISGPYEI GNLEKAGGAD FTDKYAVATL       300
     PKDKSATSFV GGSNLVVFKD SPNRDAAWKL VQWLSQPEVQ VKWYQATGDL PSVQSAWQEG       360
     VLADDPMLSV FGDQLKDTNS PPAVPTWTQV SAAADSQVEQ IVKAGKDPAQ ALQELQSQAA       420
     SIGIGR                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page