(data stored in ACNUC30630 zone)

EMBL: CP001737.PE496

CP001737.PE496       Location/Qualifiers
FT   CDS             complement(573852..574961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0515"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: cak:Caul_0415 LacI family transcription
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76934"
FT                   /db_xref="GOA:C8X765"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C8X765"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ACV76934.1"
FT                   /translation="MAKAPTVYDVAERAGVSIATVSFAFRRPEKVKASTRDMVLAVARE
FT                   MGYVPSASARGLAHGRTRAIGLFAFDYLLDSLDRQPPTAAAGSGPADPAGVVEVADPNE
FT                   DFRLFPLYVDEIQRGVGLECWRRGYALLIGGRGHADTDAVIADIAGRVDALAVFPRTVP
FT                   ADTLQRISRRMPVVELSEPGQLDELNHVTVDNVRGTRAVTDHLITAHRLTDFGFLGDTT
FT                   GSDQQARFTGFRAALRAAGLRVPRKSLSPNGTTTFDTGAIVDRLVASGHLPKALVCATD
FT                   QDALAAIDALRRAGVTVPGDVAVVGFDGIVAGRIGHPTLTTVRQPMEQMGREVVDILVS
FT                   QLDQPGQPPIRRELPTRVVIRESCGCPTS"
     MAKAPTVYDV AERAGVSIAT VSFAFRRPEK VKASTRDMVL AVAREMGYVP SASARGLAHG        60
     RTRAIGLFAF DYLLDSLDRQ PPTAAAGSGP ADPAGVVEVA DPNEDFRLFP LYVDEIQRGV       120
     GLECWRRGYA LLIGGRGHAD TDAVIADIAG RVDALAVFPR TVPADTLQRI SRRMPVVELS       180
     EPGQLDELNH VTVDNVRGTR AVTDHLITAH RLTDFGFLGD TTGSDQQARF TGFRAALRAA       240
     GLRVPRKSLS PNGTTTFDTG AIVDRLVASG HLPKALVCAT DQDALAAIDA LRRAGVTVPG       300
     DVAVVGFDGI VAGRIGHPTL TTVRQPMEQM GREVVDILVS QLDQPGQPPI RRELPTRVVI       360
     RESCGCPTS                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page