(data stored in ACNUC30630 zone)

EMBL: CP001737.PE500

CP001737.PE500       Location/Qualifiers
FT   CDS             complement(578922..579536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0520"
FT                   /product="YheO domain protein"
FT                   /note="PFAM: YheO domain protein; KEGG: sme:SMc04327
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76938"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:C8X769"
FT                   /inference="protein motif:PFAM:PF08348"
FT                   /protein_id="ACV76938.1"
FT                   /translation="MDDQWWAPQAPVVAAVVALFHPHVEVVAHDIRRDRVVAVWNPLSG
FT                   RKIGDPSLLEPELLQAQRSDAVIGPYPKVDEHGGRWTSVSVPLGQGQGLLCINFDRSAV
FT                   DGAAELLTRFAAAVQPRPDALFERDWPHEVNVLVDDWCRAAQVPRSRLSRPQRLELVAH
FT                   LDGKGVFAVRHAAGHVATSLGVSRATVYDLLKTVRTREESR"
     MDDQWWAPQA PVVAAVVALF HPHVEVVAHD IRRDRVVAVW NPLSGRKIGD PSLLEPELLQ        60
     AQRSDAVIGP YPKVDEHGGR WTSVSVPLGQ GQGLLCINFD RSAVDGAAEL LTRFAAAVQP       120
     RPDALFERDW PHEVNVLVDD WCRAAQVPRS RLSRPQRLEL VAHLDGKGVF AVRHAAGHVA       180
     TSLGVSRATV YDLLKTVRTR EESR                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page