(data stored in ACNUC30630 zone)

EMBL: CP001737.PE506

CP001737.PE506       Location/Qualifiers
FT   CDS             complement(585145..586599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0526"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   scl:sce2733 bis(5'-nucleosyl)- tetraphosphatase
FT                   (symmetrical)"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76944"
FT                   /db_xref="GOA:C8X775"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C8X775"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACV76944.1"
FT                   /translation="MIDLPRPALVVLVGPSGAGKTTWARTHFAANEVVSADALRATVGS
FT                   GEGDLDASVDAFAVLDTVVAARLRRGLTTVIDTLGLDGDRRRTAVALGRRAGLPCVAVV
FT                   FTTALEVCRTRNRARDRPVPAPALRSQHRRTAEIELGDDGFDRILRVDTAGEPVRAGVA
FT                   AAGPAPPPRPGLRFGLQVSAFGWGADPRGWLRDVAVAAERAGFAALSVMDHLLQIPQVG
FT                   RAWDPIPEAYVTLGYLAGVTERIELGPLVTPVTFRSAPLLAKMLATLDTVAPGRVFCGL
FT                   GAGWYAREHAAYGLPGSAFEAIDLPSPRARLDALEETIGVLRAFWGAGTKPYGPFPETT
FT                   CYPRPGPIPILVGGGGERHTLRIAATLADGCNLPSTVDLDRKLAVFRAHAVAAGRDPAG
FT                   LRITVLDVPIVGADPDAVARLVERHRGRSKATAYAAAHHAGTPDAHVARYTRLAEAGVD
FT                   TVFVSLPDLSGPAEIEQFAPVISAFG"
     MIDLPRPALV VLVGPSGAGK TTWARTHFAA NEVVSADALR ATVGSGEGDL DASVDAFAVL        60
     DTVVAARLRR GLTTVIDTLG LDGDRRRTAV ALGRRAGLPC VAVVFTTALE VCRTRNRARD       120
     RPVPAPALRS QHRRTAEIEL GDDGFDRILR VDTAGEPVRA GVAAAGPAPP PRPGLRFGLQ       180
     VSAFGWGADP RGWLRDVAVA AERAGFAALS VMDHLLQIPQ VGRAWDPIPE AYVTLGYLAG       240
     VTERIELGPL VTPVTFRSAP LLAKMLATLD TVAPGRVFCG LGAGWYAREH AAYGLPGSAF       300
     EAIDLPSPRA RLDALEETIG VLRAFWGAGT KPYGPFPETT CYPRPGPIPI LVGGGGERHT       360
     LRIAATLADG CNLPSTVDLD RKLAVFRAHA VAAGRDPAGL RITVLDVPIV GADPDAVARL       420
     VERHRGRSKA TAYAAAHHAG TPDAHVARYT RLAEAGVDTV FVSLPDLSGP AEIEQFAPVI       480
     SAFG                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page