(data stored in ACNUC30630 zone)

EMBL: CP001737.PE512

CP001737.PE512       Location/Qualifiers
FT   CDS             592783..593277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76950"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:C8X781"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76950.1"
FT                   /translation="MSTAGTNTTEGFGVAVTREDSTWRCSLLAPELLDDLDGVITGLRR
FT                   VASSGPVFAMLAVDDEFFVIVRPIPGGAALLLSDATAGLDYDIAADVLDLLQVQIPEDD
FT                   EVDDEPWPEGDLGLLADLGVAEQEMQLIVDDVDLYPDEQLSMIAARCGFADAFSAILEK
FT                   V"
     MSTAGTNTTE GFGVAVTRED STWRCSLLAP ELLDDLDGVI TGLRRVASSG PVFAMLAVDD        60
     EFFVIVRPIP GGAALLLSDA TAGLDYDIAA DVLDLLQVQI PEDDEVDDEP WPEGDLGLLA       120
     DLGVAEQEMQ LIVDDVDLYP DEQLSMIAAR CGFADAFSAI LEKV                        164
//

If you have problems or comments...

PBIL Back to PBIL home page