(data stored in ACNUC30630 zone)

EMBL: CP001737.PE513

CP001737.PE513       Location/Qualifiers
FT   CDS             593289..593768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0534"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   ade:Adeh_3638 tRNA-adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76951"
FT                   /db_xref="GOA:C8X782"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C8X782"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ACV76951.1"
FT                   /translation="MPGARDAADAELIRQALNLARRAPDTGDLPIGALVLDPDGVVIGR
FT                   GRNAREATGDPTAHAEILALRQAAAARGQWNLTGCTLAVTVEPCTMCAGAVVLARIETV
FT                   VFGCWEPKTGAAGSLWDVLRDRRLTHRVQVRGGVLEQESAQLLRTFFADHRQPGE"
     MPGARDAADA ELIRQALNLA RRAPDTGDLP IGALVLDPDG VVIGRGRNAR EATGDPTAHA        60
     EILALRQAAA ARGQWNLTGC TLAVTVEPCT MCAGAVVLAR IETVVFGCWE PKTGAAGSLW       120
     DVLRDRRLTH RVQVRGGVLE QESAQLLRTF FADHRQPGE                              159
//

If you have problems or comments...

PBIL Back to PBIL home page