(data stored in ACNUC30630 zone)

EMBL: CP001737.PE514

CP001737.PE514       Location/Qualifiers
FT   CDS             593775..594824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0535"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   ara:Arad_3301 oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76952"
FT                   /db_xref="GOA:C8X783"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C8X783"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACV76952.1"
FT                   /translation="MQLGVYSFGDIHPNPVTHEKVSPAQRMADLLERIRLAEQVGLDFF
FT                   GIGEHHRPDYAVSAPATVLAAAAGQTSRIGLGSAVTVLSTEDPVRVYQQYATIDLISRG
FT                   RVELMAGRGSFIESYPLFGAELSDYDALYDEKIQLLLQIDAGNPVTWSGQFRPRLDKAV
FT                   ILPRPYPKPELGEHLRISVATGGNPESSVRAGLLGLPVNYAIIGGQPARFAPLVDLYRR
FT                   ACAQSERRGAVPQVAVSGMGFISDDGRALDTFFPYWFDSMRRIARERRFPAPDRASYEA
FT                   QAAPGGAYFIGTPEQVAERIVTLHGVLGHDRQLFQMDLSSVPQADSLRAIELLGTAVVP
FT                   LVRAEIGTA"
     MQLGVYSFGD IHPNPVTHEK VSPAQRMADL LERIRLAEQV GLDFFGIGEH HRPDYAVSAP        60
     ATVLAAAAGQ TSRIGLGSAV TVLSTEDPVR VYQQYATIDL ISRGRVELMA GRGSFIESYP       120
     LFGAELSDYD ALYDEKIQLL LQIDAGNPVT WSGQFRPRLD KAVILPRPYP KPELGEHLRI       180
     SVATGGNPES SVRAGLLGLP VNYAIIGGQP ARFAPLVDLY RRACAQSERR GAVPQVAVSG       240
     MGFISDDGRA LDTFFPYWFD SMRRIARERR FPAPDRASYE AQAAPGGAYF IGTPEQVAER       300
     IVTLHGVLGH DRQLFQMDLS SVPQADSLRA IELLGTAVVP LVRAEIGTA                   349
//

If you have problems or comments...

PBIL Back to PBIL home page