(data stored in ACNUC30630 zone)

EMBL: CP001737.PE515

CP001737.PE515       Location/Qualifiers
FT   CDS             595051..596076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0536"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   bra:BRADO4353 putative alcohol dehydrogenase
FT                   (zinc-containing)(AdhT-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76953"
FT                   /db_xref="GOA:C8X784"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8X784"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACV76953.1"
FT                   /translation="MRAVRVVGYHRNLELTEVPKPEITGPHDVIVKIGGAGVCRTDLHI
FT                   LEGQWEPKTHVALPYTIGHENAGWVDAVGSAVTNVKVGDKVIMHPLITCGLCRACRFGD
FT                   DVHCENSQFPGIDTEGGYADYLKTSARSVVKIDDSLEPADVAALADAGLTAYHAAAKAA
FT                   RKLRPGDRCVMIGAGGLGHIGIQVLKALSPADLIVVDRNPAALELAKSIGADITVVADG
FT                   TEVQQILDITGGHGAEQVIDFVGEGGSTAKGLDMTRRAGDYHVVGYGENVDIATIDLIS
FT                   TERNIIGNLVGSYNDLVELMALAARGKVTLHTAKYRLDQFQDALDDLDAGKVRGRAILI
FT                   P"
     MRAVRVVGYH RNLELTEVPK PEITGPHDVI VKIGGAGVCR TDLHILEGQW EPKTHVALPY        60
     TIGHENAGWV DAVGSAVTNV KVGDKVIMHP LITCGLCRAC RFGDDVHCEN SQFPGIDTEG       120
     GYADYLKTSA RSVVKIDDSL EPADVAALAD AGLTAYHAAA KAARKLRPGD RCVMIGAGGL       180
     GHIGIQVLKA LSPADLIVVD RNPAALELAK SIGADITVVA DGTEVQQILD ITGGHGAEQV       240
     IDFVGEGGST AKGLDMTRRA GDYHVVGYGE NVDIATIDLI STERNIIGNL VGSYNDLVEL       300
     MALAARGKVT LHTAKYRLDQ FQDALDDLDA GKVRGRAILI P                           341
//

If you have problems or comments...

PBIL Back to PBIL home page