(data stored in ACNUC30630 zone)

EMBL: CP001737.PE517

CP001737.PE517       Location/Qualifiers
FT   CDS             597854..598441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0538"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mno:Mnod_1665
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76955"
FT                   /db_xref="GOA:C8X786"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C8X786"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACV76955.1"
FT                   /translation="MPPPPAARDRVLDALERLLVASGERAATLEAVAREAGVSKGGLIY
FT                   HFPSREAMVEGLLDRMRARAADDLALMAAAPEGVVAYFLRTSQNADTPFDRSLVAATRL
FT                   RSHASAREALGEVQRQWYDAILTAVGDQTVAQMVMLMGDGLYYNASAPDALASVGTPQY
FT                   QAKVEDMVELVAALVRLRGEAGQGRSTPAQPV"
     MPPPPAARDR VLDALERLLV ASGERAATLE AVAREAGVSK GGLIYHFPSR EAMVEGLLDR        60
     MRARAADDLA LMAAAPEGVV AYFLRTSQNA DTPFDRSLVA ATRLRSHASA REALGEVQRQ       120
     WYDAILTAVG DQTVAQMVML MGDGLYYNAS APDALASVGT PQYQAKVEDM VELVAALVRL       180
     RGEAGQGRST PAQPV                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page