(data stored in ACNUC30630 zone)

EMBL: CP001737.PE523

CP001737.PE523       Location/Qualifiers
FT   CDS             complement(606718..607866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0545"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: scl:sce5432 putative two-component system
FT                   sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76961"
FT                   /db_xref="GOA:C8X792"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8X792"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ACV76961.1"
FT                   /translation="MATSALRSLWAEPRPTNAPDLGPRDWALVAALTCWSVIEAVLRQD
FT                   LASGPLLLLAALAVIGPLLWRRTHPLLAVVVCFGTLTIVDLVRILTGPHGALLNSTAAT
FT                   LILTYALFRWGSGREAVCGLGIVLLWLPITIHGADPTSLAEAVAGYAFFLFAAALGAAI
FT                   RYRTKIRIREIDHAKAREREQLARELHDTVAHHVSGIVIQAQAGRAVAASHPEQAVEAL
FT                   AVIEDAATRTLTELRAIVGVLRASQDTELAPQPGVAQVEQLATDGLTRPCVEVTLSGEF
FT                   DNLSPAVGAAIYRLAQESITNARRHARHATQVSVAVHGDADQVRLTVDDDGSAAGGRGP
FT                   AGYGLVGMRERALLLGGTFDAGPAAERGWRVEAVLPRTGRPR"
     MATSALRSLW AEPRPTNAPD LGPRDWALVA ALTCWSVIEA VLRQDLASGP LLLLAALAVI        60
     GPLLWRRTHP LLAVVVCFGT LTIVDLVRIL TGPHGALLNS TAATLILTYA LFRWGSGREA       120
     VCGLGIVLLW LPITIHGADP TSLAEAVAGY AFFLFAAALG AAIRYRTKIR IREIDHAKAR       180
     EREQLARELH DTVAHHVSGI VIQAQAGRAV AASHPEQAVE ALAVIEDAAT RTLTELRAIV       240
     GVLRASQDTE LAPQPGVAQV EQLATDGLTR PCVEVTLSGE FDNLSPAVGA AIYRLAQESI       300
     TNARRHARHA TQVSVAVHGD ADQVRLTVDD DGSAAGGRGP AGYGLVGMRE RALLLGGTFD       360
     AGPAAERGWR VEAVLPRTGR PR                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page