(data stored in ACNUC30630 zone)

EMBL: CP001737.PE528

CP001737.PE528       Location/Qualifiers
FT   CDS             complement(609975..611918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0550"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: ade:Adeh_2705 response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76966"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C8X797"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACV76966.1"
FT                   /translation="MTARRRYSYRAYDGGPDPLAPPFDLREAIDRIGADVLDGSSPRQA
FT                   LQELLRRGLGERRGLDELTRQLWQRRRELQRNNRLDGTLQQVRELLDRALTAERKALAR
FT                   QDSDDARFGELQLDALPTDAAGAVRELENYDWQSPDGRAAYEQIRDLLGREMLDQRFAG
FT                   MKQALENATSQDVQAIRDMLADLNELLSAHARLEDTTERFGEFMNRHGHFFPEQPRTTD
FT                   ELIDVLAARSAAAQRMMNSLSADQRAELAALTEQAFGDPRLAQSLAQLDAMLQQLRPGQ
FT                   DWDGSGRFRGDNPMGMGEATRALEELGRLESLGEQLAQGYPGASLDDIDLDLLQDVLGE
FT                   QARVDARALAELERELREQGLLERAADGSLQLSPKALRRLGQTALRDIADQVAGRSGER
FT                   ETRRSGPAGEASGATRPWAFGDTEPWHVPRTLLNAQVRRAGGDPRVLDVTDVEVVETER
FT                   RARAAVALCVDTSWSMVQEGRWVPMKRTALALHQLISTRFRGDDLALITFGRHAEKVEL
FT                   GQLVGLEGAYVQGTNLHHALLLAGAHLRRHPDATPVVLVVTDGEPTAHLEPDGSPHFSY
FT                   PPDPETVHATVGELDRLTGLRAAVTFFILGDDPRLALFTDKLARRCGGRVVAPDLDGLG
FT                   ASVVADYLRHRR"
     MTARRRYSYR AYDGGPDPLA PPFDLREAID RIGADVLDGS SPRQALQELL RRGLGERRGL        60
     DELTRQLWQR RRELQRNNRL DGTLQQVREL LDRALTAERK ALARQDSDDA RFGELQLDAL       120
     PTDAAGAVRE LENYDWQSPD GRAAYEQIRD LLGREMLDQR FAGMKQALEN ATSQDVQAIR       180
     DMLADLNELL SAHARLEDTT ERFGEFMNRH GHFFPEQPRT TDELIDVLAA RSAAAQRMMN       240
     SLSADQRAEL AALTEQAFGD PRLAQSLAQL DAMLQQLRPG QDWDGSGRFR GDNPMGMGEA       300
     TRALEELGRL ESLGEQLAQG YPGASLDDID LDLLQDVLGE QARVDARALA ELERELREQG       360
     LLERAADGSL QLSPKALRRL GQTALRDIAD QVAGRSGERE TRRSGPAGEA SGATRPWAFG       420
     DTEPWHVPRT LLNAQVRRAG GDPRVLDVTD VEVVETERRA RAAVALCVDT SWSMVQEGRW       480
     VPMKRTALAL HQLISTRFRG DDLALITFGR HAEKVELGQL VGLEGAYVQG TNLHHALLLA       540
     GAHLRRHPDA TPVVLVVTDG EPTAHLEPDG SPHFSYPPDP ETVHATVGEL DRLTGLRAAV       600
     TFFILGDDPR LALFTDKLAR RCGGRVVAPD LDGLGASVVA DYLRHRR                     647
//

If you have problems or comments...

PBIL Back to PBIL home page