(data stored in ACNUC30630 zone)

EMBL: CP001737.PE534

CP001737.PE534       Location/Qualifiers
FT   CDS             complement(617772..618983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0556"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   xac:XAC2234 MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76972"
FT                   /db_xref="GOA:C8X7A3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7A3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACV76972.1"
FT                   /translation="MSEPHTPAPSRVGATVGLVLLALNLRGPLVAISAVAVDLQTDLGM
FT                   TAGTVGLLTSLPVLCFGLASPAASGLIGRLGIEIAVLATLLVIFIGILVRSAGAVPAAF
FT                   VGTLLIGLAITVGNVLGPLIVGRDFRTRVAQMTGAYTAALNVGSMVALAVSGPLAVAFG
FT                   WQVALAAGAVVPVLAAVVWVPLTARARRRRAAAAARPTPAQPDRPRESVPRVSVLRRPS
FT                   TWLLTGAFAGQAYAYYGLTAWLPTVLGDQVGMTRGEAGAASSIFQIAALIGAFGAPVII
FT                   NRMGGPLVAFLVNGVLWTALPLGLLLAPELWAVWSAASGIAQGGGFVTIFTVVVWRARS
FT                   LRENRQLSSVVQTGGYCVACLGPTVLGVLRDSTGAWSASLLTAVVGTMTLMVLGALASV
FT                   GLKR"
     MSEPHTPAPS RVGATVGLVL LALNLRGPLV AISAVAVDLQ TDLGMTAGTV GLLTSLPVLC        60
     FGLASPAASG LIGRLGIEIA VLATLLVIFI GILVRSAGAV PAAFVGTLLI GLAITVGNVL       120
     GPLIVGRDFR TRVAQMTGAY TAALNVGSMV ALAVSGPLAV AFGWQVALAA GAVVPVLAAV       180
     VWVPLTARAR RRRAAAAARP TPAQPDRPRE SVPRVSVLRR PSTWLLTGAF AGQAYAYYGL       240
     TAWLPTVLGD QVGMTRGEAG AASSIFQIAA LIGAFGAPVI INRMGGPLVA FLVNGVLWTA       300
     LPLGLLLAPE LWAVWSAASG IAQGGGFVTI FTVVVWRARS LRENRQLSSV VQTGGYCVAC       360
     LGPTVLGVLR DSTGAWSASL LTAVVGTMTL MVLGALASVG LKR                         403
//

If you have problems or comments...

PBIL Back to PBIL home page