(data stored in ACNUC30630 zone)

EMBL: CP001737.PE535

CP001737.PE535       Location/Qualifiers
FT   CDS             619121..620020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0557"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76973"
FT                   /db_xref="GOA:C8X7A4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:4Y7D"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7A4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACV76973.1"
FT                   /translation="MATSEASRDESVQTVSTARGEVDCVIVGAGPPVLVVHGSPGGHDA
FT                   GLAMARFLVAEGLRAIVVDRPGYFGTPLGSGVTPDEQAELYAALFDALGLAAAGVLCWS
FT                   GGGPSSYRLAARHPDRVRALVSVAAVSHRYHFDGEKGAEKVLMGTGLGRRMLQLMAAHT
FT                   PEKLVSATIAAEGHLSKEHVAERVAQIMADPDKERFTLELAVSANHSGPRKAGFDNDMD
FT                   QFARIDSLELDRITAPTLVVSGTADSDVDPEFSRFAAAQIAGSELVHLDAGTHLAFWVH
FT                   PDSGPVRRRAAELLRAGG"
     MATSEASRDE SVQTVSTARG EVDCVIVGAG PPVLVVHGSP GGHDAGLAMA RFLVAEGLRA        60
     IVVDRPGYFG TPLGSGVTPD EQAELYAALF DALGLAAAGV LCWSGGGPSS YRLAARHPDR       120
     VRALVSVAAV SHRYHFDGEK GAEKVLMGTG LGRRMLQLMA AHTPEKLVSA TIAAEGHLSK       180
     EHVAERVAQI MADPDKERFT LELAVSANHS GPRKAGFDND MDQFARIDSL ELDRITAPTL       240
     VVSGTADSDV DPEFSRFAAA QIAGSELVHL DAGTHLAFWV HPDSGPVRRR AAELLRAGG        299
//

If you have problems or comments...

PBIL Back to PBIL home page