(data stored in ACNUC30630 zone)

EMBL: CP001737.PE536

CP001737.PE536       Location/Qualifiers
FT   CDS             complement(620034..620444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0558"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: bba:Bd3635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76974"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7A5"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ACV76974.1"
FT                   /translation="MTSRPVGLTRDAGFQIGVSRSVAVPLEQVWDTLVSDAGVRTWLGA
FT                   DVQLPSAAGAPYRTATGTTGEVRSFHPHDRVRLTWRPPDWNHESTVQVTVSRRNGRTVL
FT                   RFHQERLADPDERDRQRAHWQSVLDSLVEQLP"
     MTSRPVGLTR DAGFQIGVSR SVAVPLEQVW DTLVSDAGVR TWLGADVQLP SAAGAPYRTA        60
     TGTTGEVRSF HPHDRVRLTW RPPDWNHEST VQVTVSRRNG RTVLRFHQER LADPDERDRQ       120
     RAHWQSVLDS LVEQLP                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page