(data stored in ACNUC30630 zone)

EMBL: CP001737.PE544

CP001737.PE544       Location/Qualifiers
FT   CDS             627718..629109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0567"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   bac:BamMC406_5857 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76982"
FT                   /db_xref="GOA:C8X7B3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7B3"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ACV76982.1"
FT                   /translation="MTALIQPAASDVTGSNGAADHLWMHFSRMGTFADKPVPVIERGEG
FT                   AYLWDTKGRKYLDALSALFVVQAGYGVEEIAAAADAQARKLCYFPVWSYATPPAIELAD
FT                   RLAELAPGDLNKVFFSSGGGESVETAWKVAKQFFKLTGKPTKTKVISRAIAYHGTTQGA
FT                   LSITGVPGFQIPFAPLVPGAIKVPNTDFYRAPEHLAGDEKEFGRWAADQFEEAILREGP
FT                   DSVAAVFVEPVQNAGGSFPPPAGYFERVREICDTYDVLLVSDEVICAYGRLGTMFGAQK
FT                   FGYQPDIITSAKGLTSGYAALGAAIISDRIFEPFGRGTTTFPHGYTFGGHPVACAAALA
FT                   NLDVFAERDLLGNVLRHEGALEATLKQLLDLPIVGDVRGNGYFWSVELVRDQATKEPFT
FT                   RDDCERILRGVVAPGMWEAGVYCRADDRGQAVVQFAPPLMCGQAEFDQIESAMRSVLTD
FT                   AWTKL"
     MTALIQPAAS DVTGSNGAAD HLWMHFSRMG TFADKPVPVI ERGEGAYLWD TKGRKYLDAL        60
     SALFVVQAGY GVEEIAAAAD AQARKLCYFP VWSYATPPAI ELADRLAELA PGDLNKVFFS       120
     SGGGESVETA WKVAKQFFKL TGKPTKTKVI SRAIAYHGTT QGALSITGVP GFQIPFAPLV       180
     PGAIKVPNTD FYRAPEHLAG DEKEFGRWAA DQFEEAILRE GPDSVAAVFV EPVQNAGGSF       240
     PPPAGYFERV REICDTYDVL LVSDEVICAY GRLGTMFGAQ KFGYQPDIIT SAKGLTSGYA       300
     ALGAAIISDR IFEPFGRGTT TFPHGYTFGG HPVACAAALA NLDVFAERDL LGNVLRHEGA       360
     LEATLKQLLD LPIVGDVRGN GYFWSVELVR DQATKEPFTR DDCERILRGV VAPGMWEAGV       420
     YCRADDRGQA VVQFAPPLMC GQAEFDQIES AMRSVLTDAW TKL                         463
//

If you have problems or comments...

PBIL Back to PBIL home page