(data stored in ACNUC30630 zone)

EMBL: CP001737.PE545

CP001737.PE545       Location/Qualifiers
FT   CDS             629178..630308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0568"
FT                   /product="alanine dehydrogenase"
FT                   /note="TIGRFAM: alanine dehydrogenase; PFAM: alanine
FT                   dehydrogenase/PNT domain protein; KEGG: lpp:lpp0986
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76983"
FT                   /db_xref="GOA:C8X7B4"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7B4"
FT                   /inference="protein motif:TFAM:TIGR00518"
FT                   /protein_id="ACV76983.1"
FT                   /translation="MSALVVGVPKEIKNNENRVSVQPDGVAELVHHGHQVLVESGAGVG
FT                   SRFSDAEYSAAGAKVVGTADEVFAAADLIVKVKEPVPAEYHRFREGQQLFTYLHLAADR
FT                   ELTEFLLAKKIDSIAYETVQTPDRKLPLLTPMSEVAGRMSVQAAARALESPAGGAGILL
FT                   GGVPGTPAAKVTIIGGGVSGTEAAKIALGMRAIVRVFDTNPTRLAYLSDIFGGRLDLVT
FT                   PNRARMAAYIADSDVVIGAVLVPGAKAPKLVSREMIASMRPGSVAVDIAIDQGGCFETS
FT                   RATTHADPTYIEEGVVHYCVANIPGAVARTSTLALTSATLPYLVKVADRGIAGAAQTDP
FT                   ALLLGLSTLGGHLVNEPVAQAHALAYRNPADLLVGV"
     MSALVVGVPK EIKNNENRVS VQPDGVAELV HHGHQVLVES GAGVGSRFSD AEYSAAGAKV        60
     VGTADEVFAA ADLIVKVKEP VPAEYHRFRE GQQLFTYLHL AADRELTEFL LAKKIDSIAY       120
     ETVQTPDRKL PLLTPMSEVA GRMSVQAAAR ALESPAGGAG ILLGGVPGTP AAKVTIIGGG       180
     VSGTEAAKIA LGMRAIVRVF DTNPTRLAYL SDIFGGRLDL VTPNRARMAA YIADSDVVIG       240
     AVLVPGAKAP KLVSREMIAS MRPGSVAVDI AIDQGGCFET SRATTHADPT YIEEGVVHYC       300
     VANIPGAVAR TSTLALTSAT LPYLVKVADR GIAGAAQTDP ALLLGLSTLG GHLVNEPVAQ       360
     AHALAYRNPA DLLVGV                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page