(data stored in ACNUC30630 zone)

EMBL: CP001737.PE556

CP001737.PE556       Location/Qualifiers
FT   CDS             639398..641491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0579"
FT                   /product="phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /note="KEGG: net:Neut_1995 phosphate acetyltransferase;
FT                   TIGRFAM: phosphate acetyltransferase; PFAM: phosphate
FT                   acetyl/butaryl transferase; DRTGG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76994"
FT                   /db_xref="GOA:C8X7C5"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR016475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7C5"
FT                   /inference="protein motif:TFAM:TIGR00651"
FT                   /protein_id="ACV76994.1"
FT                   /translation="MTGPVSLSPMSRSLYIASPEALSGKSAVALGLVDLLSRRVGRVGV
FT                   FRPIVNADPQRDSVVELLIAQPGIRQDYDEAVGVTYAQWHADQDAALSRIVDRFGELSA
FT                   EYDAVVVVGSDYTDVTTGNEWASNARIAANLGSPVVLVVHGRDRTPAVIAATVELARSE
FT                   LVAWHAHPVAAIANRVDPDAVEDVRERLSRAGLVAGALPNIPLLGAPTVADLRDACGAT
FT                   LWRGDEDLLTRESLGFLVAAMTPPNVLRRLRPSMTVIAPGDRSDMLPALILAHQSATFP
FT                   DLASVVLTGGYEPPASIAKLIDGIRADVPILLTDGGTFETATGLGQVRGRLTADSSVKL
FT                   EKALQAFAEGVDADAIVDALDLADPTVVTPMMFQYRLIERARADRRHVVLPEGEEERIL
FT                   RAAAILLRLDVADLTLLGDETLIRAKADTLGLDIAKARIVSPTTPELVATFAAEYARLR
FT                   AHKGITLELATDIVSDVSYFGTMMVHLGMADGMVSGAVHTTAHTIRPSFEIIKTAPGTT
FT                   VVSSVFLMCLADRVLVYGDCAVNPDPTAEQLAEIAISSAQTAAQFGVDPRVAMLSYSTG
FT                   SSGSGADVEKVRTATDIVHTKRPDLLVEGPIQYDAAVDPGVAVTKLPDSQVAGRATVLI
FT                   FPDLNTGNNTYKAVQRSAGAVAIGPVLQGLNKPVNDLSRGALVADIVNTVAITAIQAQG
FT                   ETA"
     MTGPVSLSPM SRSLYIASPE ALSGKSAVAL GLVDLLSRRV GRVGVFRPIV NADPQRDSVV        60
     ELLIAQPGIR QDYDEAVGVT YAQWHADQDA ALSRIVDRFG ELSAEYDAVV VVGSDYTDVT       120
     TGNEWASNAR IAANLGSPVV LVVHGRDRTP AVIAATVELA RSELVAWHAH PVAAIANRVD       180
     PDAVEDVRER LSRAGLVAGA LPNIPLLGAP TVADLRDACG ATLWRGDEDL LTRESLGFLV       240
     AAMTPPNVLR RLRPSMTVIA PGDRSDMLPA LILAHQSATF PDLASVVLTG GYEPPASIAK       300
     LIDGIRADVP ILLTDGGTFE TATGLGQVRG RLTADSSVKL EKALQAFAEG VDADAIVDAL       360
     DLADPTVVTP MMFQYRLIER ARADRRHVVL PEGEEERILR AAAILLRLDV ADLTLLGDET       420
     LIRAKADTLG LDIAKARIVS PTTPELVATF AAEYARLRAH KGITLELATD IVSDVSYFGT       480
     MMVHLGMADG MVSGAVHTTA HTIRPSFEII KTAPGTTVVS SVFLMCLADR VLVYGDCAVN       540
     PDPTAEQLAE IAISSAQTAA QFGVDPRVAM LSYSTGSSGS GADVEKVRTA TDIVHTKRPD       600
     LLVEGPIQYD AAVDPGVAVT KLPDSQVAGR ATVLIFPDLN TGNNTYKAVQ RSAGAVAIGP       660
     VLQGLNKPVN DLSRGALVAD IVNTVAITAI QAQGETA                                697
//

If you have problems or comments...

PBIL Back to PBIL home page