(data stored in ACNUC30630 zone)

EMBL: CP001737.PE557

CP001737.PE557       Location/Qualifiers
FT   CDS             641488..642687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0580"
FT                   /product="acetate kinase"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: gur:Gura_2656 acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76995"
FT                   /db_xref="GOA:C8X7C6"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7C6"
FT                   /inference="protein motif:TFAM:TIGR00016"
FT                   /protein_id="ACV76995.1"
FT                   /translation="MIQHPILVVNSGSSSMKYQLIDPDEGQAVTTGLIERIGVAGAEPG
FT                   RATHRQDGKDFDYTGEIADHAAAIEVMRSLFDRSGRPIQRTGLFAVGHRVVHGGSLFGE
FT                   PTLVDAQVLAEIKALSVLAPLHNPANATGIEEAMAAFPGVAQVAVFDTAFFRDLPAAAA
FT                   TYAIDRTVAAEHQVRRYGFHGTSHQYVSQQVAAVLGRELAQLRQIVLHLGNGASVSAVD
FT                   GGRAVETSMGLTPLEGLVMGTRSGDIDPGVVFHLARTAGLSIDEIDSLLNRRSGMLGLA
FT                   GVSDFRDIDRLIEQGDTDAALALDVYCHRVRKYIGAYLAVLGGADVITFTAGVGENAAG
FT                   VRAKVLAGLEPLGIRLDPARNAERGGARVISTDDSPVTVLVVPTNEELAIARATLALVR
FT                   "
     MIQHPILVVN SGSSSMKYQL IDPDEGQAVT TGLIERIGVA GAEPGRATHR QDGKDFDYTG        60
     EIADHAAAIE VMRSLFDRSG RPIQRTGLFA VGHRVVHGGS LFGEPTLVDA QVLAEIKALS       120
     VLAPLHNPAN ATGIEEAMAA FPGVAQVAVF DTAFFRDLPA AAATYAIDRT VAAEHQVRRY       180
     GFHGTSHQYV SQQVAAVLGR ELAQLRQIVL HLGNGASVSA VDGGRAVETS MGLTPLEGLV       240
     MGTRSGDIDP GVVFHLARTA GLSIDEIDSL LNRRSGMLGL AGVSDFRDID RLIEQGDTDA       300
     ALALDVYCHR VRKYIGAYLA VLGGADVITF TAGVGENAAG VRAKVLAGLE PLGIRLDPAR       360
     NAERGGARVI STDDSPVTVL VVPTNEELAI ARATLALVR                              399
//

If you have problems or comments...

PBIL Back to PBIL home page