(data stored in ACNUC30630 zone)

EMBL: CP001737.PE558

CP001737.PE558       Location/Qualifiers
FT   CDS             642694..643617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0581"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: mrd:Mrad2831_4098
FT                   auxin efflux carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76996"
FT                   /db_xref="GOA:C8X7C7"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7C7"
FT                   /inference="protein motif:PFAM:PF03547"
FT                   /protein_id="ACV76996.1"
FT                   /translation="MLAVLQGLATIGIVVGVGYLLARTSLLPSGTPVVLSRLVFFVATP
FT                   ALLLETLAGASISAVLSAGLAVTALTTTVAWSLYLLVARLWWKRDTASVVVGSLASSYV
FT                   NAGNLGIPLAVYVFGDAALVAPVMLYQLVVLAPVAFVVLDMVESGRRPSWRRVLIQPVR
FT                   NPVIVASVIGISLAATGAHIPQLIDAPLKLIAGMAVPGALIAFGISLRGAPIPGRGGRA
FT                   ADLSLAAALKLVVMPVAAYALGRWVFGMSGVPLLASTMCAALPTAQNVFVYAVRYKAAV
FT                   PLARDAVATSTLLCIPVLVVIAGLLS"
     MLAVLQGLAT IGIVVGVGYL LARTSLLPSG TPVVLSRLVF FVATPALLLE TLAGASISAV        60
     LSAGLAVTAL TTTVAWSLYL LVARLWWKRD TASVVVGSLA SSYVNAGNLG IPLAVYVFGD       120
     AALVAPVMLY QLVVLAPVAF VVLDMVESGR RPSWRRVLIQ PVRNPVIVAS VIGISLAATG       180
     AHIPQLIDAP LKLIAGMAVP GALIAFGISL RGAPIPGRGG RAADLSLAAA LKLVVMPVAA       240
     YALGRWVFGM SGVPLLASTM CAALPTAQNV FVYAVRYKAA VPLARDAVAT STLLCIPVLV       300
     VIAGLLS                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page