(data stored in ACNUC30630 zone)

EMBL: CP001737.PE565

CP001737.PE565       Location/Qualifiers
FT   CDS             complement(647890..648720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0588"
FT                   /product="transcriptional regulator, PaaX family"
FT                   /note="PFAM: PaaX domain protein domain; PaaX domain
FT                   protein; KEGG: bbr:BB3436 phenylacetic acid degradation
FT                   operon negative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77003"
FT                   /db_xref="GOA:C8X827"
FT                   /db_xref="InterPro:IPR011965"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C8X827"
FT                   /inference="protein motif:PFAM:PF08223"
FT                   /protein_id="ACV77003.1"
FT                   /translation="MAAPTGSAVLPPDRPGSPSSVIVSFAGSFLREIGGAIAVSDLIRC
FT                   LAAAGVAEPAVRQALSRLKARGFLDPDRVDGRAGYRLTAAGLADLNSGDRRIFHRPSTS
FT                   EADGWVLAVFSVPESERAQRHRLRSELSWLGFGTVAAGVWAAPRHLAEPTRQVLAAADL
FT                   DHYVTWFQAHHLSPIQVGQWWDLPALRDQYEQFLRQHSSDLAVPDEELTDEQAFAHYLR
FT                   VIDSWRVFPRIDPGLPATLLPPDWPAAQAWSTFASLHDRWAQRGLAHVWAVVAG"
     MAAPTGSAVL PPDRPGSPSS VIVSFAGSFL REIGGAIAVS DLIRCLAAAG VAEPAVRQAL        60
     SRLKARGFLD PDRVDGRAGY RLTAAGLADL NSGDRRIFHR PSTSEADGWV LAVFSVPESE       120
     RAQRHRLRSE LSWLGFGTVA AGVWAAPRHL AEPTRQVLAA ADLDHYVTWF QAHHLSPIQV       180
     GQWWDLPALR DQYEQFLRQH SSDLAVPDEE LTDEQAFAHY LRVIDSWRVF PRIDPGLPAT       240
     LLPPDWPAAQ AWSTFASLHD RWAQRGLAHV WAVVAG                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page