(data stored in ACNUC30630 zone)

EMBL: CP001737.PE568

CP001737.PE568       Location/Qualifiers
FT   CDS             651208..651651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0591"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: hch:HCH_04806
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77006"
FT                   /db_xref="GOA:C8X830"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C8X830"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACV77006.1"
FT                   /translation="MATMTRSSDTSTSARSAVATATGLVVLRVVLGAVMIVHGWQKFFV
FT                   DGISGVSGFFGQMGVPLAGFSAAAVATVELVGGVLLILGLGTRVVGALYALCMVGAIVF
FT                   VHGANGFLAAAGGYEFVLVLAAVSAALALLGGGRYALDALIKR"
     MATMTRSSDT STSARSAVAT ATGLVVLRVV LGAVMIVHGW QKFFVDGISG VSGFFGQMGV        60
     PLAGFSAAAV ATVELVGGVL LILGLGTRVV GALYALCMVG AIVFVHGANG FLAAAGGYEF       120
     VLVLAAVSAA LALLGGGRYA LDALIKR                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page