(data stored in ACNUC30630 zone)

EMBL: CP001737.PE570

CP001737.PE570       Location/Qualifiers
FT   CDS             complement(652133..653491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0593"
FT                   /product="pyridoxal-phosphate dependent TrpB-like enzyme"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: hypothetical protein; K06001 tryptophan
FT                   synthase beta chain; TIGRFAM: pyridoxal-phosphate dependent
FT                   TrpB-like enzyme; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77008"
FT                   /db_xref="GOA:C8X832"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006316"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C8X832"
FT                   /inference="protein motif:TFAM:TIGR01415"
FT                   /protein_id="ACV77008.1"
FT                   /translation="MPIRQHKYLLDESEMPTSWYNIVPDLPAPPPPPLHPGTHEPVGPD
FT                   DLAPLFPMDLILQEVSTERYIPIPDEVQDVYRLWRPSPLFRAHRLEQALGTPARIYYKY
FT                   EGVSPAGSHKPNTAVPQVYYNAKAGVKKLTTETGAGQWGTALAFACSLFDVECEVWQVG
FT                   ASYDAKPYRRTVIETFGGTVHRSPSQLTSAGRAFAADHPGSLGIAISEAVEKAAGAADT
FT                   KYALGSVLNHVLLHQTVIGEEALLQLAKAGETGADLVIGCTGGGSNFGGLAFPFLREKL
FT                   AGRQNPVIRAVEPASCPSLTRGEYRYDFGDTAGFTPLMKMHTLGHDFVPDPIHAGGLRY
FT                   HGMAPLISHIYELGLMEALSIEQTECFAAAVRFARTEGIVPAPEPTHALAATMREALAC
FT                   KESGEEKVIVTALCGHGLLDLGAYDAYLNDRMVDSGLSDADLDAALSTIPVLT"
     MPIRQHKYLL DESEMPTSWY NIVPDLPAPP PPPLHPGTHE PVGPDDLAPL FPMDLILQEV        60
     STERYIPIPD EVQDVYRLWR PSPLFRAHRL EQALGTPARI YYKYEGVSPA GSHKPNTAVP       120
     QVYYNAKAGV KKLTTETGAG QWGTALAFAC SLFDVECEVW QVGASYDAKP YRRTVIETFG       180
     GTVHRSPSQL TSAGRAFAAD HPGSLGIAIS EAVEKAAGAA DTKYALGSVL NHVLLHQTVI       240
     GEEALLQLAK AGETGADLVI GCTGGGSNFG GLAFPFLREK LAGRQNPVIR AVEPASCPSL       300
     TRGEYRYDFG DTAGFTPLMK MHTLGHDFVP DPIHAGGLRY HGMAPLISHI YELGLMEALS       360
     IEQTECFAAA VRFARTEGIV PAPEPTHALA ATMREALACK ESGEEKVIVT ALCGHGLLDL       420
     GAYDAYLNDR MVDSGLSDAD LDAALSTIPV LT                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page