(data stored in ACNUC30630 zone)

EMBL: CP001737.PE571

CP001737.PE571       Location/Qualifiers
FT   CDS             complement(653558..655588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0594"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: rpt:Rpal_3142
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77009"
FT                   /db_xref="GOA:C8X833"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C8X833"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACV77009.1"
FT                   /translation="MFDTGWDAGLDDAQLSAVVHGDGPLVILAGAGTGKTRTLTARVAS
FT                   LLDRGVPAERVLLLTFTRRAADEMVSRAARLCTQPDAGQRLAGGTFHAVAHAVIGRHTE
FT                   ALGLPPAVSVLDRADATDVMDLLRHDHGLDGTDRRFPRAATLVDIYSRAVNTGVPARAL
FT                   IKTDFGWVQPHVDAVMELFRAYVARKRDRGLLDFDDLLLAWRSLLADPVVGPQIAGRWD
FT                   HVLVDEYQDVNATQVDIVHALRPGGHGLTVVGDDAQAIYGFRGSDHAHLRSLVQELPEV
FT                   TVVRLERNFRSHQRLLDLANVVRPGAEGEHRITLHSDRREGRPARLVRCHDAPAEARII
FT                   VDSVLEAHQKGRRLREQAVLMRAAAHSDLLEVELTARGVPFVKYGGLKFLEAAHVKDFV
FT                   AAVRLLDNPRDEVAWYRLLRLHDGIGPARARSLLGSLADPELSADLDRHAEAVAAAPAM
FT                   SRVALAASLSTLADARSRNRIGERARGCLELLRPLLTARYRDWSARLGDLERLVGAADQ
FT                   SPDLAAFVAELTLDPPASTSDLAGPPSQDDDYLVLSTVHSAKGLEWPVVHVLHLVDGSF
FT                   PSDMALGTPEGVEEEARLFYVALTRAADELNLYAPLRMPHHRHARDDRHSMAPLSRFLD
FT                   DAALDRVEVVDLTPPRPGADPAGAAARGTRVALPDLADLWA"
     MFDTGWDAGL DDAQLSAVVH GDGPLVILAG AGTGKTRTLT ARVASLLDRG VPAERVLLLT        60
     FTRRAADEMV SRAARLCTQP DAGQRLAGGT FHAVAHAVIG RHTEALGLPP AVSVLDRADA       120
     TDVMDLLRHD HGLDGTDRRF PRAATLVDIY SRAVNTGVPA RALIKTDFGW VQPHVDAVME       180
     LFRAYVARKR DRGLLDFDDL LLAWRSLLAD PVVGPQIAGR WDHVLVDEYQ DVNATQVDIV       240
     HALRPGGHGL TVVGDDAQAI YGFRGSDHAH LRSLVQELPE VTVVRLERNF RSHQRLLDLA       300
     NVVRPGAEGE HRITLHSDRR EGRPARLVRC HDAPAEARII VDSVLEAHQK GRRLREQAVL       360
     MRAAAHSDLL EVELTARGVP FVKYGGLKFL EAAHVKDFVA AVRLLDNPRD EVAWYRLLRL       420
     HDGIGPARAR SLLGSLADPE LSADLDRHAE AVAAAPAMSR VALAASLSTL ADARSRNRIG       480
     ERARGCLELL RPLLTARYRD WSARLGDLER LVGAADQSPD LAAFVAELTL DPPASTSDLA       540
     GPPSQDDDYL VLSTVHSAKG LEWPVVHVLH LVDGSFPSDM ALGTPEGVEE EARLFYVALT       600
     RAADELNLYA PLRMPHHRHA RDDRHSMAPL SRFLDDAALD RVEVVDLTPP RPGADPAGAA       660
     ARGTRVALPD LADLWA                                                       676
//

If you have problems or comments...

PBIL Back to PBIL home page