(data stored in ACNUC30630 zone)

EMBL: CP001737.PE578

CP001737.PE578       Location/Qualifiers
FT   CDS             662931..663857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0601"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   mmw:Mmwyl1_2683 dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77016"
FT                   /db_xref="GOA:C8X840"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C8X840"
FT                   /inference="protein motif:PFAM:PF00701"
FT                   /protein_id="ACV77016.1"
FT                   /translation="MSLGNLDLRGLNPAPVTPFTVDGDVDYAALAGLGKFLASVEGVKS
FT                   LVVLGHAGEGTFLTQDEQVKVIETLVAEVGDQVAIVAGITGEGTKVAVEEAQRAVAAGA
FT                   KAALTYPSHGWLRFGYQDGAPQDRYRAIWEEAGLPQILFQYPDNTKASYNLDTQLEIAG
FT                   QEGVFWTKNGVRNMRRWDTEIPVLRREYPDLQIFSCHDEYLLHTIMDVDGLLVGYGNIA
FT                   PELLVEFIKAGKAQDWTAAKKIHNQLLPVTKSVYHRGSHMEGTVALKHALVARGILPHA
FT                   TVRSPLLPLADGADVEIADALKAAGII"
     MSLGNLDLRG LNPAPVTPFT VDGDVDYAAL AGLGKFLASV EGVKSLVVLG HAGEGTFLTQ        60
     DEQVKVIETL VAEVGDQVAI VAGITGEGTK VAVEEAQRAV AAGAKAALTY PSHGWLRFGY       120
     QDGAPQDRYR AIWEEAGLPQ ILFQYPDNTK ASYNLDTQLE IAGQEGVFWT KNGVRNMRRW       180
     DTEIPVLRRE YPDLQIFSCH DEYLLHTIMD VDGLLVGYGN IAPELLVEFI KAGKAQDWTA       240
     AKKIHNQLLP VTKSVYHRGS HMEGTVALKH ALVARGILPH ATVRSPLLPL ADGADVEIAD       300
     ALKAAGII                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page