(data stored in ACNUC30630 zone)

EMBL: CP001737.PE579

CP001737.PE579       Location/Qualifiers
FT   CDS             664139..665518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0602"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; General
FT                   substrate transporter; KEGG: abb:ABBFA_002694 inner
FT                   membrane metabolite transport protein YgcS"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77017"
FT                   /db_xref="GOA:C8X841"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8X841"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACV77017.1"
FT                   /translation="MTTSYAGEPTAVANAQLVSRLERIPVTRRLLLIRVIIGSATFFDA
FT                   YTVLVIAFAMPQLVTEWGLSPTQVGLILSAGYVGQIFGALGFGQLAEKIGRLPTLLITI
FT                   ILFVSMDVACLFATGGTMMMIFRFLQGVGTGGEVPVASAYINEFIGAKKRGKFFLLYEL
FT                   IFPIGLMSAGIIGYFLVPAFGWKALFIVGLVPAILMIPLRVLMPESPRWLASRGKIDKA
FT                   DKVVTMLENEAIKQGKPLPEPVVRPVDPKTTAKSDWRELFKGIYLKRTLMIWVLWIAAY
FT                   TINNGMVTWLPTLYKTTFGMNTQDAIFYGWITSAVGVLASVVCALTIDRVGRKRWYTWA
FT                   FLLAVVPLVTLYFLGATTALQVTVFATATYAILQTISFSLYLYSAELYPTRLRAIGTGF
FT                   GSAWLRAGSSIGPVLVGFIVAGVGIQFVFLAFAAIAVIGGLTVSRFGVETKGRVLEELS
FT                   P"
     MTTSYAGEPT AVANAQLVSR LERIPVTRRL LLIRVIIGSA TFFDAYTVLV IAFAMPQLVT        60
     EWGLSPTQVG LILSAGYVGQ IFGALGFGQL AEKIGRLPTL LITIILFVSM DVACLFATGG       120
     TMMMIFRFLQ GVGTGGEVPV ASAYINEFIG AKKRGKFFLL YELIFPIGLM SAGIIGYFLV       180
     PAFGWKALFI VGLVPAILMI PLRVLMPESP RWLASRGKID KADKVVTMLE NEAIKQGKPL       240
     PEPVVRPVDP KTTAKSDWRE LFKGIYLKRT LMIWVLWIAA YTINNGMVTW LPTLYKTTFG       300
     MNTQDAIFYG WITSAVGVLA SVVCALTIDR VGRKRWYTWA FLLAVVPLVT LYFLGATTAL       360
     QVTVFATATY AILQTISFSL YLYSAELYPT RLRAIGTGFG SAWLRAGSSI GPVLVGFIVA       420
     GVGIQFVFLA FAAIAVIGGL TVSRFGVETK GRVLEELSP                              459
//

If you have problems or comments...

PBIL Back to PBIL home page