(data stored in ACNUC30630 zone)

EMBL: CP001737.PE61

CP001737.PE61        Location/Qualifiers
FT   CDS             complement(73877..74155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76499"
FT                   /db_xref="UniProtKB/TrEMBL:C8XI08"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76499.1"
FT                   /translation="MTALLLDIPTDLTNRPTETAADPRAGLPVATERVAGAAFCVDLDP
FT                   GLLSFTRRRIAEHFAVADDQVDVMITSGLLRLSQRLSRVLANRPATC"
     MTALLLDIPT DLTNRPTETA ADPRAGLPVA TERVAGAAFC VDLDPGLLSF TRRRIAEHFA        60
     VADDQVDVMI TSGLLRLSQR LSRVLANRPA TC                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page