(data stored in ACNUC30630 zone)

EMBL: CP001737.PE62

CP001737.PE62        Location/Qualifiers
FT   CDS             complement(74205..74315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76500"
FT                   /db_xref="GOA:C8XIR3"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIR3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76500.1"
FT                   /translation="MNSIREMYKAAPDLVVTVASLLGLALVLGVTTLFVS"
     MNSIREMYKA APDLVVTVAS LLGLALVLGV TTLFVS                                  36
//

If you have problems or comments...

PBIL Back to PBIL home page