(data stored in ACNUC30630 zone)

EMBL: CP001737.PE66

CP001737.PE66        Location/Qualifiers
FT   CDS             76818..77432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0067"
FT                   /product="DNJ31; DnaJ-like protein"
FT                   /note="KEGG: DNJ31; DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76504"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR018567"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIR7"
FT                   /inference="similar to AA sequence:KEGG:CHLREDRAFT_36125"
FT                   /protein_id="ACV76504.1"
FT                   /translation="MRGWVILAAAALSALVTGCAGGGAAGSGTSAASTITITEGTRTAV
FT                   RSVTVTPEPSAAPAAGAASATAPPATDEPAPVAGTCPYLSDDTVADINGQRTGVTTVIE
FT                   VDPHPICTFTRSDGGWLATVRIVQADSPAAAAAAVDQHVPVESSNPADDPAGWTGGSMA
FT                   TGDGSVYAVAKGSVAVIAEANQPQSIKGRQLAVTAIANLGL"
     MRGWVILAAA ALSALVTGCA GGGAAGSGTS AASTITITEG TRTAVRSVTV TPEPSAAPAA        60
     GAASATAPPA TDEPAPVAGT CPYLSDDTVA DINGQRTGVT TVIEVDPHPI CTFTRSDGGW       120
     LATVRIVQAD SPAAAAAAVD QHVPVESSNP ADDPAGWTGG SMATGDGSVY AVAKGSVAVI       180
     AEANQPQSIK GRQLAVTAIA NLGL                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page