(data stored in ACNUC30630 zone)

EMBL: CP001737.PE73

CP001737.PE73        Location/Qualifiers
FT   CDS             81550..81705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76511"
FT                   /db_xref="GOA:C8XIS4"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIS4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76511.1"
FT                   /translation="MYAWIWRHLPGPTAARAGISVVLFLAVVALLFFVVFPWLEPYLPF
FT                   DRVTTG"
     MYAWIWRHLP GPTAARAGIS VVLFLAVVAL LFFVVFPWLE PYLPFDRVTT G                 51
//

If you have problems or comments...

PBIL Back to PBIL home page