(data stored in ACNUC30630 zone)

EMBL: CP001737.PE77

CP001737.PE77        Location/Qualifiers
FT   CDS             complement(87562..89043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0079"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: aeh:Mlg_0172 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76515"
FT                   /db_xref="GOA:C8XIS8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIS8"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ACV76515.1"
FT                   /translation="MKRPLRRLGTAVIVMVVLLLANIAYTQVIKADDYRADPNNKRTLV
FT                   AEYSRQRGQITAAGGVVLARSDPVDDQYSYQRVYPEGAAYAHPVGYYSMRYGPTGIERN
FT                   QNEILSGEAPELIAGQLSDLITGRDPRGGNVQLTLVPAVQQAAYSAMADKGYVGAVVAM
FT                   EPSTGNILAMVSTPSYDPNPLASHSDATQRQAYNDLVNADPSPLLNRAVSAVYPPGSTF
FT                   KLVIAAAALQNGYTPQTTVTGEPTITLPGTGGATLSNFGGETCADAGGEDVTLTQALAH
FT                   SCNTAFAEVAMSLGAPVVRKQAEALGVTGDGVDVGMDVVGSRLGDIPDTAALAQTGIGQ
FT                   RDVAVTPFEMAWVTATIANRGDQMAPHLIAQTTKPDLTVISQTQPESLGQAIPIPVADQ
FT                   LKDMMIESEKQTPLSGSIADLVIASKTGTAEHGTDPKNTPPHAWYVAFAPADNPKVAVA
FT                   VLVENGGDLGVEATGARVAGPVGRSVIAAALAGGS"
     MKRPLRRLGT AVIVMVVLLL ANIAYTQVIK ADDYRADPNN KRTLVAEYSR QRGQITAAGG        60
     VVLARSDPVD DQYSYQRVYP EGAAYAHPVG YYSMRYGPTG IERNQNEILS GEAPELIAGQ       120
     LSDLITGRDP RGGNVQLTLV PAVQQAAYSA MADKGYVGAV VAMEPSTGNI LAMVSTPSYD       180
     PNPLASHSDA TQRQAYNDLV NADPSPLLNR AVSAVYPPGS TFKLVIAAAA LQNGYTPQTT       240
     VTGEPTITLP GTGGATLSNF GGETCADAGG EDVTLTQALA HSCNTAFAEV AMSLGAPVVR       300
     KQAEALGVTG DGVDVGMDVV GSRLGDIPDT AALAQTGIGQ RDVAVTPFEM AWVTATIANR       360
     GDQMAPHLIA QTTKPDLTVI SQTQPESLGQ AIPIPVADQL KDMMIESEKQ TPLSGSIADL       420
     VIASKTGTAE HGTDPKNTPP HAWYVAFAPA DNPKVAVAVL VENGGDLGVE ATGARVAGPV       480
     GRSVIAAALA GGS                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page