(data stored in ACNUC30630 zone)

EMBL: CP001737.PE78

CP001737.PE78        Location/Qualifiers
FT   CDS             complement(89040..90503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0080"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: gur:Gura_3975 cell
FT                   division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76516"
FT                   /db_xref="GOA:C8XIS9"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIS9"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ACV76516.1"
FT                   /translation="MSRRPDATAGARPIRTGRTAEFWMLVFAAVVVTSALVIVELNQSR
FT                   TLSWSLAYYGGGYLLALAVAHLLIRRYAPYADPLLLPIVALLNGIGLVMIYRLDLAREI
FT                   SAINRGEEVPTPQASLQLVWTAVALVFFLVVLLVVRDHTVLQSYAYTLALVGVVFLIIP
FT                   ALLPSSLSEVNGAKIWIRVPGLFSIQPAEFAKIALIIFAAAFLVSKRTVLSTAGKKVFG
FT                   LVLPRGRDLGPLLVALLLVLGVLVLGKDLGSALLIFGTFLAMIYVATGRVSWLIIGVLG
FT                   FSAGAYLAYRMFSHVRVRVDIWLDPFADPLGNGYQLVQSLFGLGTGGIFGTGLGAGRPD
FT                   IVPFASTDFIMAALGEELGLVGVTAILLCYLILTARGIRTGLAAKDGFGTLLAGGLSFS
FT                   LALQMFIVVGGVTRLIPLTGLTTPFLSYGGSSLLSNYVILALLVRISDSSRRPPEPVRP
FT                   APTPEVPLDEAHTQMVPAVPAAQRAGGRS"
     MSRRPDATAG ARPIRTGRTA EFWMLVFAAV VVTSALVIVE LNQSRTLSWS LAYYGGGYLL        60
     ALAVAHLLIR RYAPYADPLL LPIVALLNGI GLVMIYRLDL AREISAINRG EEVPTPQASL       120
     QLVWTAVALV FFLVVLLVVR DHTVLQSYAY TLALVGVVFL IIPALLPSSL SEVNGAKIWI       180
     RVPGLFSIQP AEFAKIALII FAAAFLVSKR TVLSTAGKKV FGLVLPRGRD LGPLLVALLL       240
     VLGVLVLGKD LGSALLIFGT FLAMIYVATG RVSWLIIGVL GFSAGAYLAY RMFSHVRVRV       300
     DIWLDPFADP LGNGYQLVQS LFGLGTGGIF GTGLGAGRPD IVPFASTDFI MAALGEELGL       360
     VGVTAILLCY LILTARGIRT GLAAKDGFGT LLAGGLSFSL ALQMFIVVGG VTRLIPLTGL       420
     TTPFLSYGGS SLLSNYVILA LLVRISDSSR RPPEPVRPAP TPEVPLDEAH TQMVPAVPAA       480
     QRAGGRS                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page