(data stored in ACNUC30630 zone)

EMBL: CP001737.PE80

CP001737.PE80        Location/Qualifiers
FT   CDS             complement(92139..92609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0082"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: scl:sce2902 GGDEF
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76518"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIT1"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACV76518.1"
FT                   /translation="MPALILQLTRIGFLVLLCLFVLAAIRVIRTDLRYAGEPRTDGGRR
FT                   RGGQAAVAQVPQGRLQPSTLVVTAGSLAGTRLRLGPGPILIGRAEDSTLVLDDDYASSR
FT                   HARLTQQGQEYYLEDLGSTNGTYLDRVRVTTPTPVPVGVPIRIGRTVIELRP"
     MPALILQLTR IGFLVLLCLF VLAAIRVIRT DLRYAGEPRT DGGRRRGGQA AVAQVPQGRL        60
     QPSTLVVTAG SLAGTRLRLG PGPILIGRAE DSTLVLDDDY ASSRHARLTQ QGQEYYLEDL       120
     GSTNGTYLDR VRVTTPTPVP VGVPIRIGRT VIELRP                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page