(data stored in ACNUC30630 zone)

EMBL: CP001737.PE83

CP001737.PE83        Location/Qualifiers
FT   CDS             97344..98744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0087"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   transposase IS111A/IS1328/IS1533; KEGG: eba:ebA6749
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76521"
FT                   /db_xref="GOA:C8XI56"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C8XI56"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACV76521.1"
FT                   /translation="MMTKQVEEILDEPHEQIVQRVCAIDVGKDSGTVCVRVPAASGTGR
FT                   RVSKVWDVPARTRAVLGLAAQLSDQGIEKVTLESTSDYWRIWFYLLEAHGLDVQLVNAR
FT                   DVKNVPGRPKTDKLDSVWLAKLTEKGLLRPSFVPSAQVRQLRDYTRMRADLTGDRTRYW
FT                   QRLEKLLEDALIKVTSVASRIDTLSVRDMIEALIAGQRDPRVLAGMARGRMRLKYADLV
FT                   ESLTGQFDDHHAELARMLLHQIDTLTDQIDVLTARIEALLASLPAGNTPDPDRPAPDGQ
FT                   TRPGTRANAPADEAAQRRTPPTAADMIKILDQIPGIGPSNAQVIIAEIGLDMSRFPTAG
FT                   HLVSWTRLCPRTIQSGKRSTTGKTGKGNRYLRAVLGEAAATGGKTQTFLGERYRRLIKR
FT                   RGKLKTIVAIARSILVIIWHLLANPGTTFHDLGVDFNDHRIDIGRRTRNHVRQLEALGF
FT                   NVTLTAAA"
     MMTKQVEEIL DEPHEQIVQR VCAIDVGKDS GTVCVRVPAA SGTGRRVSKV WDVPARTRAV        60
     LGLAAQLSDQ GIEKVTLEST SDYWRIWFYL LEAHGLDVQL VNARDVKNVP GRPKTDKLDS       120
     VWLAKLTEKG LLRPSFVPSA QVRQLRDYTR MRADLTGDRT RYWQRLEKLL EDALIKVTSV       180
     ASRIDTLSVR DMIEALIAGQ RDPRVLAGMA RGRMRLKYAD LVESLTGQFD DHHAELARML       240
     LHQIDTLTDQ IDVLTARIEA LLASLPAGNT PDPDRPAPDG QTRPGTRANA PADEAAQRRT       300
     PPTAADMIKI LDQIPGIGPS NAQVIIAEIG LDMSRFPTAG HLVSWTRLCP RTIQSGKRST       360
     TGKTGKGNRY LRAVLGEAAA TGGKTQTFLG ERYRRLIKRR GKLKTIVAIA RSILVIIWHL       420
     LANPGTTFHD LGVDFNDHRI DIGRRTRNHV RQLEALGFNV TLTAAA                      466
//

If you have problems or comments...

PBIL Back to PBIL home page