(data stored in ACNUC30630 zone)

EMBL: CP001737.PE84

CP001737.PE84        Location/Qualifiers
FT   CDS             complement(99639..99794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76522"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIT5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76522.1"
FT                   /translation="MSTTPRPTKSGAALAFVPQRPAIVAKFRGALTLPARPERFRLFGS
FT                   QAVAIW"
     MSTTPRPTKS GAALAFVPQR PAIVAKFRGA LTLPARPERF RLFGSQAVAI W                 51
//

If you have problems or comments...

PBIL Back to PBIL home page