(data stored in ACNUC30630 zone)

EMBL: CP001737.PE88

CP001737.PE88        Location/Qualifiers
FT   CDS             103192..104178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0092"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76526"
FT                   /db_xref="GOA:C8XIT9"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIT9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76526.1"
FT                   /translation="MTFAGGFRLAIGLLLTVGTLGVLFTALDPIWNGHPAYPATLLVGT
FT                   AVGLVLIASAFWSQGRPDDLPTGQEVTPARPPRWRRVLRITGRVVGAVLVVVVLAILVW
FT                   LRPFPAGAGARSALTADASVTVVDRPTSIELVPAGTPDTALVFVPGARVDARAYAQILR
FT                   PVAEAGHLVVILKAPFGMAIAQPGQAGGVIEDHPEIGTWAVGGHSLGGVVASWYAQDHP
FT                   DQIDGLLLFGSYSDRDLSARTDLAVESVWGSNDGLTTPDDIDRTRGNLPATTEFTEIVG
FT                   GVHAYFGDYGEQPGDGSPQIDRDQATAEISAAAVDFMNGFGGARSGR"
     MTFAGGFRLA IGLLLTVGTL GVLFTALDPI WNGHPAYPAT LLVGTAVGLV LIASAFWSQG        60
     RPDDLPTGQE VTPARPPRWR RVLRITGRVV GAVLVVVVLA ILVWLRPFPA GAGARSALTA       120
     DASVTVVDRP TSIELVPAGT PDTALVFVPG ARVDARAYAQ ILRPVAEAGH LVVILKAPFG       180
     MAIAQPGQAG GVIEDHPEIG TWAVGGHSLG GVVASWYAQD HPDQIDGLLL FGSYSDRDLS       240
     ARTDLAVESV WGSNDGLTTP DDIDRTRGNL PATTEFTEIV GGVHAYFGDY GEQPGDGSPQ       300
     IDRDQATAEI SAAAVDFMNG FGGARSGR                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page