(data stored in ACNUC30630 zone)

EMBL: CP001737.PE95

CP001737.PE95        Location/Qualifiers
FT   CDS             111020..111550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76533"
FT                   /db_xref="InterPro:IPR027595"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIU6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76533.1"
FT                   /translation="MGSVGRSTAETAPRDGQRAKVYEAEHLVHRIFDRSAEYPVVQIAG
FT                   SQLVLPPERRFGSVPAVQVYVRRVLDLGWVRATWPRATVPVRVRERAGSTQAHYERAGA
FT                   VMAVPGYRTGSGWALRELVILHELAHHLADQVEPAHGGPFVDRLLTLVDGVIGAEAALL
FT                   MRITMLDAGVAIG"
     MGSVGRSTAE TAPRDGQRAK VYEAEHLVHR IFDRSAEYPV VQIAGSQLVL PPERRFGSVP        60
     AVQVYVRRVL DLGWVRATWP RATVPVRVRE RAGSTQAHYE RAGAVMAVPG YRTGSGWALR       120
     ELVILHELAH HLADQVEPAH GGPFVDRLLT LVDGVIGAEA ALLMRITMLD AGVAIG           176
//

If you have problems or comments...

PBIL Back to PBIL home page