(data stored in ACNUC30630 zone)

EMBL: CP001737.PE99

CP001737.PE99        Location/Qualifiers
FT   CDS             complement(113236..113610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0103"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: bmt:BSUIS_A1504 methyltransferase type
FT                   11"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76537"
FT                   /db_xref="GOA:C8XIV0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIV0"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACV76537.1"
FT                   /translation="MTTTRARPALPLTDLAACCSPPPGRVLDPAEADRLAGVLKALAEP
FT                   NRLRLVSMIAANAVGGATCVCDLIEPLGLSQPTVSHHLKVLTDAGLLTREQRGKWAYFS
FT                   LIPGALAAVAAAITPAGVPE"
     MTTTRARPAL PLTDLAACCS PPPGRVLDPA EADRLAGVLK ALAEPNRLRL VSMIAANAVG        60
     GATCVCDLIE PLGLSQPTVS HHLKVLTDAG LLTREQRGKW AYFSLIPGAL AAVAAAITPA       120
     GVPE                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page