(data stored in ACNUC30630 zone)

EMBL: CP001738.PE11

CP001738.PE11        Location/Qualifiers
FT   CDS             15415..15654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95620"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95620.1"
FT                   /translation="MLSDLVYDGKGGLWMRAGQKLLHYKSGKWKTVSLPRKDGLRPEIN
FT                   ALAHIPKTTSVWAVGALADEREVYQSSVILKYGK"
     MLSDLVYDGK GGLWMRAGQK LLHYKSGKWK TVSLPRKDGL RPEINALAHI PKTTSVWAVG        60
     ALADEREVYQ SSVILKYGK                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page