(data stored in ACNUC30630 zone)

EMBL: CP001738.PE110

CP001738.PE110       Location/Qualifiers
FT   CDS             complement(116918..118036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0111"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: scl:sce5432 putative two-component system
FT                   sensor kinase; PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; SMART: ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95719"
FT                   /db_xref="GOA:D1AEA3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEA3"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACY95719.1"
FT                   /translation="MRLPQGRAADAAIAGGMFALMAVAGLRAFIGERLEPWPVTVAGWA
FT                   LTAAACGALYLRRRRPVAVAVFVLAVTIAYYLGSAYDGPLLVVFIVALYTVAAEGRLQA
FT                   AVALAALALICVGAGTLAGNDEVNGIALFMLAGWLVAVVALGQVRHGRLAYLQEVQRRA
FT                   AGEERLRIARELHDVVGHHLSLINVQSAAALHRIGKDPAQAKAALGAIKESSRTALRDL
FT                   RATLGVLRESGEQAPTAPAPGLARLEELIESARLAGLQVHAETGGEQRPLPTEVDLAAY
FT                   RIVQEALTNVTRHARAGAVTVRLDHGPGELTVEVTDDGRGPVPPAGPPGSGISGMRERA
FT                   RALGGELVAGPRPGGGFTVRARLPYRNGASAR"
     MRLPQGRAAD AAIAGGMFAL MAVAGLRAFI GERLEPWPVT VAGWALTAAA CGALYLRRRR        60
     PVAVAVFVLA VTIAYYLGSA YDGPLLVVFI VALYTVAAEG RLQAAVALAA LALICVGAGT       120
     LAGNDEVNGI ALFMLAGWLV AVVALGQVRH GRLAYLQEVQ RRAAGEERLR IARELHDVVG       180
     HHLSLINVQS AAALHRIGKD PAQAKAALGA IKESSRTALR DLRATLGVLR ESGEQAPTAP       240
     APGLARLEEL IESARLAGLQ VHAETGGEQR PLPTEVDLAA YRIVQEALTN VTRHARAGAV       300
     TVRLDHGPGE LTVEVTDDGR GPVPPAGPPG SGISGMRERA RALGGELVAG PRPGGGFTVR       360
     ARLPYRNGAS AR                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page