(data stored in ACNUC30630 zone)

EMBL: CP001738.PE119

CP001738.PE119       Location/Qualifiers
FT   CDS             128644..129561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0121"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: ade:Adeh_1779 prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95728"
FT                   /db_xref="GOA:D1AEB2"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEB2"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ACY95728.1"
FT                   /translation="MRYAYLGPQGTFTEAALHAVPEAKDAEHVPYSTVPAALDALRRGE
FT                   VDAAVVALENSVEGSVPTTLDELATGQPLQIVGEVQLPVSFALLVRPGTDFADIKTVAS
FT                   HPHAQPQCRRWLAAHIPDAEWRAATSNAEAAQMVADGHYDAALAGAFAAARYGLSVLAE
FT                   DIHDVPDAVTRFVVLRRPCPPPEPTGMDRTSVVAFIGEDHPGALLEILTEFAVRGINLT
FT                   LIQSRPTGTGLGSYRFWMDFEGHVAEKRVGEALMGLRRICADVRFLGSYMRADRIRPEI
FT                   RRGTHDADFIEAAAWLAGIRSGRL"
     MRYAYLGPQG TFTEAALHAV PEAKDAEHVP YSTVPAALDA LRRGEVDAAV VALENSVEGS        60
     VPTTLDELAT GQPLQIVGEV QLPVSFALLV RPGTDFADIK TVASHPHAQP QCRRWLAAHI       120
     PDAEWRAATS NAEAAQMVAD GHYDAALAGA FAAARYGLSV LAEDIHDVPD AVTRFVVLRR       180
     PCPPPEPTGM DRTSVVAFIG EDHPGALLEI LTEFAVRGIN LTLIQSRPTG TGLGSYRFWM       240
     DFEGHVAEKR VGEALMGLRR ICADVRFLGS YMRADRIRPE IRRGTHDADF IEAAAWLAGI       300
     RSGRL                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page