(data stored in ACNUC30630 zone)

EMBL: CP001738.PE124

CP001738.PE124       Location/Qualifiers
FT   CDS             134013..134870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0126"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: scl:sce2325 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95733"
FT                   /db_xref="GOA:D1AEB7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEB7"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACY95733.1"
FT                   /translation="MYAGAGEDGLAERKAPPRLVATDLDGTLVRSDGTISARTVQALAR
FT                   VERAGSTLVMVTGRPPRWMRDAAAAVDHRGIAICANGAVLYDLHTETVLRTRLIEAEVV
FT                   DEVVRRLREAAPEFRFAVEYTDGFVYEASYDLGRWDLEALGGRPVGERELVSRGGIKLL
FT                   AFHPGADPDRLAEETRKAVGDLVTVTHSSGRGLMEMSAHGVTKASALAELCAERGVAAA
FT                   DVVAFGDMPNDLPMLTWAGTSYGVANGHPDVLSAVTHTIGRNDDDGVAKVLEQLFPATG
FT                   ADVR"
     MYAGAGEDGL AERKAPPRLV ATDLDGTLVR SDGTISARTV QALARVERAG STLVMVTGRP        60
     PRWMRDAAAA VDHRGIAICA NGAVLYDLHT ETVLRTRLIE AEVVDEVVRR LREAAPEFRF       120
     AVEYTDGFVY EASYDLGRWD LEALGGRPVG ERELVSRGGI KLLAFHPGAD PDRLAEETRK       180
     AVGDLVTVTH SSGRGLMEMS AHGVTKASAL AELCAERGVA AADVVAFGDM PNDLPMLTWA       240
     GTSYGVANGH PDVLSAVTHT IGRNDDDGVA KVLEQLFPAT GADVR                       285
//

If you have problems or comments...

PBIL Back to PBIL home page