(data stored in ACNUC30630 zone)

EMBL: CP001738.PE13

CP001738.PE13        Location/Qualifiers
FT   CDS             complement(17587..18336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95622"
FT                   /db_xref="GOA:D1ADB2"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95622.1"
FT                   /translation="MNTALIFTFSNNVDIYINSILHLGDKYAVSKFSFIFVTGATIEGP
FT                   STDFADKIVSGLEDLSAGIYKNSSIEIDDRIKSRCAATVDNLKASQSNQELAQPVPLEE
FT                   LEKFLERQSKQARPGRLFIDVTGLPKVLMSHVMLIGIAGGHETYAFELHKQPDRAHPEK
FT                   SLYFFIPPGGFSYYPLRQSPAVQSVFRKLIHVRRILRTTTATLIVGIICFSILTFIDSQ
FT                   NPILATIGLVSNLIGIASGIYQMRSPR"
     MNTALIFTFS NNVDIYINSI LHLGDKYAVS KFSFIFVTGA TIEGPSTDFA DKIVSGLEDL        60
     SAGIYKNSSI EIDDRIKSRC AATVDNLKAS QSNQELAQPV PLEELEKFLE RQSKQARPGR       120
     LFIDVTGLPK VLMSHVMLIG IAGGHETYAF ELHKQPDRAH PEKSLYFFIP PGGFSYYPLR       180
     QSPAVQSVFR KLIHVRRILR TTTATLIVGI ICFSILTFID SQNPILATIG LVSNLIGIAS       240
     GIYQMRSPR                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page