(data stored in ACNUC30630 zone)

EMBL: CP001738.PE130

CP001738.PE130       Location/Qualifiers
FT   CDS             complement(142210..143388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0132"
FT                   /product="protein-L-isoaspartate(D-aspartate)O-methyltrans
FT                   ferase"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate) O-
FT                   methyltransferase; Methyltransferase type 11; KEGG:
FT                   mch:Mchl_4629 protein-L-isoaspartate O- methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95739"
FT                   /db_xref="GOA:D1AEC3"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEC3"
FT                   /inference="protein motif:PFAM:PF01135"
FT                   /protein_id="ACY95739.1"
FT                   /translation="MTPATTTTPEWLAEAVASGRLDAGWVQVFAALPRSLFLPDVIWPK
FT                   DPDSGQNVRVDRRRDPSGWAAWAEQDVPIVTQWDDQPDPAAAGQTATSSSSQPSLVAGM
FT                   LADLDVRPGHRVLDLGVGTGWTTALLAARVAAGTVVGIEYDPAVAEAARARITAVGLVA
FT                   DVIVGDGAAGWPDGAPYDRVQCTYAVRRIPTAWVEQTRPGGVILAPWETTLTHQGALVR
FT                   LTVQEDGIASGPFLWPVRFMGSRPERTPQIDRNDYLPPGGGWPPGTVESATRLRPADLW
FT                   ATPYGPAWWMIGLLVPDMVYATSSRKDGTVLGWLFSLRCRSWAIAFFDDAPEAEVYQGG
FT                   PRRLWDEVEAAHRWWTEQGRPGHEDFGLTVGPDGERVWLRSPDRPLPATLAG"
     MTPATTTTPE WLAEAVASGR LDAGWVQVFA ALPRSLFLPD VIWPKDPDSG QNVRVDRRRD        60
     PSGWAAWAEQ DVPIVTQWDD QPDPAAAGQT ATSSSSQPSL VAGMLADLDV RPGHRVLDLG       120
     VGTGWTTALL AARVAAGTVV GIEYDPAVAE AARARITAVG LVADVIVGDG AAGWPDGAPY       180
     DRVQCTYAVR RIPTAWVEQT RPGGVILAPW ETTLTHQGAL VRLTVQEDGI ASGPFLWPVR       240
     FMGSRPERTP QIDRNDYLPP GGGWPPGTVE SATRLRPADL WATPYGPAWW MIGLLVPDMV       300
     YATSSRKDGT VLGWLFSLRC RSWAIAFFDD APEAEVYQGG PRRLWDEVEA AHRWWTEQGR       360
     PGHEDFGLTV GPDGERVWLR SPDRPLPATL AG                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page